Update inference_app.py
Browse files- inference_app.py +16 -15
inference_app.py
CHANGED
|
@@ -11,7 +11,7 @@ from gradio_molecule3d import Molecule3D
|
|
| 11 |
def predict (input_sequence, input_ligand, input_protein):
|
| 12 |
start_time = time.time()
|
| 13 |
# Do inference here
|
| 14 |
-
# return an output pdb file with the protein and
|
| 15 |
end_time = time.time()
|
| 16 |
run_time = end_time - start_time
|
| 17 |
return "test_out.pdb", run_time
|
|
@@ -22,9 +22,13 @@ with gr.Blocks() as app:
|
|
| 22 |
|
| 23 |
gr.Markdown("Title, description, and other information about the model")
|
| 24 |
with gr.Row():
|
| 25 |
-
|
| 26 |
-
|
| 27 |
-
|
|
|
|
|
|
|
|
|
|
|
|
|
| 28 |
|
| 29 |
|
| 30 |
# define any options here
|
|
@@ -39,9 +43,11 @@ with gr.Blocks() as app:
|
|
| 39 |
gr.Examples(
|
| 40 |
[
|
| 41 |
[
|
| 42 |
-
"
|
| 43 |
-
"
|
| 44 |
-
"
|
|
|
|
|
|
|
| 45 |
],
|
| 46 |
],
|
| 47 |
[input_sequence, input_ligand],
|
|
@@ -50,17 +56,12 @@ with gr.Blocks() as app:
|
|
| 50 |
{
|
| 51 |
"model": 0,
|
| 52 |
"style": "cartoon",
|
|
|
|
| 53 |
"color": "whiteCarbon",
|
| 54 |
-
},
|
| 55 |
-
{
|
| 56 |
-
"model": 0,
|
| 57 |
-
"resname": "UNK",
|
| 58 |
-
"style": "stick",
|
| 59 |
-
"color": "greenCarbon",
|
| 60 |
},
|
| 61 |
{
|
| 62 |
"model": 0,
|
| 63 |
-
"
|
| 64 |
"style": "stick",
|
| 65 |
"color": "greenCarbon",
|
| 66 |
}
|
|
@@ -70,6 +71,6 @@ with gr.Blocks() as app:
|
|
| 70 |
out = Molecule3D(reps=reps)
|
| 71 |
run_time = gr.Textbox(label="Runtime")
|
| 72 |
|
| 73 |
-
btn.click(predict, inputs=[
|
| 74 |
|
| 75 |
app.launch()
|
|
|
|
| 11 |
def predict (input_sequence, input_ligand, input_protein):
|
| 12 |
start_time = time.time()
|
| 13 |
# Do inference here
|
| 14 |
+
# return an output pdb file with the protein and two chains A and B.
|
| 15 |
end_time = time.time()
|
| 16 |
run_time = end_time - start_time
|
| 17 |
return "test_out.pdb", run_time
|
|
|
|
| 22 |
|
| 23 |
gr.Markdown("Title, description, and other information about the model")
|
| 24 |
with gr.Row():
|
| 25 |
+
with gr.Column():
|
| 26 |
+
input_seq_1 = gr.Textbox(lines=3, label="Input Protein 1 sequence (FASTA)")
|
| 27 |
+
input_protein_1 = gr.File(label="Input Protein 2 monomer (PDB)")
|
| 28 |
+
with gr.Column():
|
| 29 |
+
input_seq_2 = gr.Textbox(lines=3, label="Input Protein 1 sequence (FASTA)")
|
| 30 |
+
input_protein_2 = gr.File(label="Input Protein 2 structure (PDB)")
|
| 31 |
+
|
| 32 |
|
| 33 |
|
| 34 |
# define any options here
|
|
|
|
| 43 |
gr.Examples(
|
| 44 |
[
|
| 45 |
[
|
| 46 |
+
"GSGSPLAQQIKNIHSFIHQAKAAGRMDEVRTLQENLHQLMHEYFQQSD",
|
| 47 |
+
"3v1c_A.pdb",
|
| 48 |
+
"GSGSPLAQQIKNIHSFIHQAKAAGRMDEVRTLQENLHQLMHEYFQQSD",
|
| 49 |
+
"3v1c_B.pdb",
|
| 50 |
+
|
| 51 |
],
|
| 52 |
],
|
| 53 |
[input_sequence, input_ligand],
|
|
|
|
| 56 |
{
|
| 57 |
"model": 0,
|
| 58 |
"style": "cartoon",
|
| 59 |
+
"chain": "A",
|
| 60 |
"color": "whiteCarbon",
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
| 61 |
},
|
| 62 |
{
|
| 63 |
"model": 0,
|
| 64 |
+
"chain": "B",
|
| 65 |
"style": "stick",
|
| 66 |
"color": "greenCarbon",
|
| 67 |
}
|
|
|
|
| 71 |
out = Molecule3D(reps=reps)
|
| 72 |
run_time = gr.Textbox(label="Runtime")
|
| 73 |
|
| 74 |
+
btn.click(predict, inputs=[input_seq_1, input_protein_1, input_seq_2, input_protein_2], outputs=[out, run_time])
|
| 75 |
|
| 76 |
app.launch()
|