Spaces:
Paused
Paused
Update app.py
Browse files
app.py
CHANGED
|
@@ -150,55 +150,18 @@ def train_function_no_sweeps(base_model_path): #, train_dataset, test_dataset)
|
|
| 150 |
"weight_decay": 0.2,
|
| 151 |
# Add other hyperparameters as needed
|
| 152 |
}
|
| 153 |
-
# The base model you will train a LoRA on top of
|
| 154 |
-
#base_model_path = "facebook/esm2_t12_35M_UR50D"
|
| 155 |
-
|
| 156 |
-
# Define labels and model
|
| 157 |
-
#id2label = {0: "No binding site", 1: "Binding site"}
|
| 158 |
-
#label2id = {v: k for k, v in id2label.items()}
|
| 159 |
|
| 160 |
-
|
| 161 |
base_model = AutoModelForTokenClassification.from_pretrained(base_model_path, num_labels=len(id2label), id2label=id2label, label2id=label2id)
|
| 162 |
-
|
| 163 |
-
'''
|
| 164 |
-
# Load the data from pickle files (replace with your local paths)
|
| 165 |
-
with open("./datasets/train_sequences_chunked_by_family.pkl", "rb") as f:
|
| 166 |
-
train_sequences = pickle.load(f)
|
| 167 |
-
|
| 168 |
-
with open("./datasets/test_sequences_chunked_by_family.pkl", "rb") as f:
|
| 169 |
-
test_sequences = pickle.load(f)
|
| 170 |
-
|
| 171 |
-
with open("./datasets/train_labels_chunked_by_family.pkl", "rb") as f:
|
| 172 |
-
train_labels = pickle.load(f)
|
| 173 |
-
|
| 174 |
-
with open("./datasets/test_labels_chunked_by_family.pkl", "rb") as f:
|
| 175 |
-
test_labels = pickle.load(f)
|
| 176 |
-
'''
|
| 177 |
|
| 178 |
# Tokenization
|
| 179 |
tokenizer = AutoTokenizer.from_pretrained(base_model_path) #("facebook/esm2_t12_35M_UR50D")
|
| 180 |
-
#max_sequence_length = 1000
|
| 181 |
|
| 182 |
train_tokenized = tokenizer(train_sequences, padding=True, truncation=True, max_length=max_sequence_length, return_tensors="pt", is_split_into_words=False)
|
| 183 |
test_tokenized = tokenizer(test_sequences, padding=True, truncation=True, max_length=max_sequence_length, return_tensors="pt", is_split_into_words=False)
|
| 184 |
|
| 185 |
-
# Directly truncate the entire list of labels
|
| 186 |
-
#train_labels = truncate_labels(train_labels, max_sequence_length)
|
| 187 |
-
#test_labels = truncate_labels(test_labels, max_sequence_length)
|
| 188 |
-
|
| 189 |
train_dataset = Dataset.from_dict({k: v for k, v in train_tokenized.items()}).add_column("labels", train_labels)
|
| 190 |
test_dataset = Dataset.from_dict({k: v for k, v in test_tokenized.items()}).add_column("labels", test_labels)
|
| 191 |
|
| 192 |
-
'''
|
| 193 |
-
# Compute Class Weights
|
| 194 |
-
classes = [0, 1]
|
| 195 |
-
flat_train_labels = [label for sublist in train_labels for label in sublist]
|
| 196 |
-
class_weights = compute_class_weight(class_weight='balanced', classes=classes, y=flat_train_labels)
|
| 197 |
-
accelerator = Accelerator()
|
| 198 |
-
class_weights = torch.tensor(class_weights, dtype=torch.float32).to(accelerator.device)
|
| 199 |
-
print(" class_weights:", class_weights)
|
| 200 |
-
'''
|
| 201 |
-
|
| 202 |
# Convert the model into a PeftModel
|
| 203 |
peft_config = LoraConfig(
|
| 204 |
task_type=TaskType.TOKEN_CLS,
|
|
@@ -217,7 +180,7 @@ def train_function_no_sweeps(base_model_path): #, train_dataset, test_dataset)
|
|
| 217 |
test_dataset = accelerator.prepare(test_dataset)
|
| 218 |
|
| 219 |
model_name_base = base_model_path.split("/")[1]
|
| 220 |
-
timestamp = datetime.now().strftime('%Y-%m-%d_%H
|
| 221 |
|
| 222 |
# Training setup
|
| 223 |
training_args = TrainingArguments(
|
|
@@ -262,9 +225,6 @@ def train_function_no_sweeps(base_model_path): #, train_dataset, test_dataset)
|
|
| 262 |
|
| 263 |
# Train and Save Model
|
| 264 |
trainer.train()
|
| 265 |
-
#save_path = os.path.join("lora_binding_sites", f"best_model_esm2_t12_35M_lora_{timestamp}")
|
| 266 |
-
#trainer.save_model(save_path)
|
| 267 |
-
#tokenizer.save_pretrained(save_path)
|
| 268 |
|
| 269 |
return save_path
|
| 270 |
|
|
@@ -279,8 +239,8 @@ MODEL_OPTIONS = [
|
|
| 279 |
] # models users can choose from
|
| 280 |
|
| 281 |
PEFT_MODEL_OPTIONS = [
|
| 282 |
-
"AmelieSchreiber/esm2_t12_35M_lora_binding_sites_v2_cp3",
|
| 283 |
"wangjin2000/esm2_t6_8M-lora-binding-sites_2024-07-02_09-26-54",
|
|
|
|
| 284 |
] # finetuned models
|
| 285 |
|
| 286 |
|
|
@@ -297,21 +257,12 @@ with open("./datasets/train_labels_chunked_by_family.pkl", "rb") as f:
|
|
| 297 |
with open("./datasets/test_labels_chunked_by_family.pkl", "rb") as f:
|
| 298 |
test_labels = pickle.load(f)
|
| 299 |
|
| 300 |
-
## Tokenization
|
| 301 |
-
#tokenizer = AutoTokenizer.from_pretrained("facebook/esm2_t12_35M_UR50D")
|
| 302 |
max_sequence_length = 1000
|
| 303 |
|
| 304 |
-
#train_tokenized = tokenizer(train_sequences, padding=True, truncation=True, max_length=max_sequence_length, return_tensors="pt", is_split_into_words=False)
|
| 305 |
-
#test_tokenized = tokenizer(test_sequences, padding=True, truncation=True, max_length=max_sequence_length, return_tensors="pt", is_split_into_words=False)
|
| 306 |
-
|
| 307 |
# Directly truncate the entire list of labels
|
| 308 |
train_labels = truncate_labels(train_labels, max_sequence_length)
|
| 309 |
test_labels = truncate_labels(test_labels, max_sequence_length)
|
| 310 |
|
| 311 |
-
#train_dataset = Dataset.from_dict({k: v for k, v in train_tokenized.items()}).add_column("labels", train_labels)
|
| 312 |
-
#test_dataset = Dataset.from_dict({k: v for k, v in test_tokenized.items()}).add_column("labels", test_labels)
|
| 313 |
-
|
| 314 |
-
|
| 315 |
# Compute Class Weights
|
| 316 |
classes = [0, 1]
|
| 317 |
flat_train_labels = [label for sublist in train_labels for label in sublist]
|
|
@@ -324,48 +275,6 @@ id2label = {0: "No binding site", 1: "Binding site"}
|
|
| 324 |
label2id = {v: k for k, v in id2label.items()}
|
| 325 |
|
| 326 |
'''
|
| 327 |
-
# inference
|
| 328 |
-
# Path to the saved LoRA model
|
| 329 |
-
model_path = "AmelieSchreiber/esm2_t12_35M_lora_binding_sites_v2_cp3"
|
| 330 |
-
# ESM2 base model
|
| 331 |
-
base_model_path = "facebook/esm2_t12_35M_UR50D"
|
| 332 |
-
|
| 333 |
-
# Load the model
|
| 334 |
-
base_model = AutoModelForTokenClassification.from_pretrained(base_model_path)
|
| 335 |
-
loaded_model = PeftModel.from_pretrained(base_model, model_path)
|
| 336 |
-
|
| 337 |
-
# Ensure the model is in evaluation mode
|
| 338 |
-
loaded_model.eval()
|
| 339 |
-
|
| 340 |
-
# Protein sequence for inference
|
| 341 |
-
protein_sequence = "MAVPETRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMKGT" # Replace with your actual sequence
|
| 342 |
-
|
| 343 |
-
# Tokenize the sequence
|
| 344 |
-
inputs = tokenizer(protein_sequence, return_tensors="pt", truncation=True, max_length=1024, padding='max_length')
|
| 345 |
-
|
| 346 |
-
# Run the model
|
| 347 |
-
with torch.no_grad():
|
| 348 |
-
logits = loaded_model(**inputs).logits
|
| 349 |
-
|
| 350 |
-
# Get predictions
|
| 351 |
-
tokens = tokenizer.convert_ids_to_tokens(inputs["input_ids"][0]) # Convert input ids back to tokens
|
| 352 |
-
predictions = torch.argmax(logits, dim=2)
|
| 353 |
-
|
| 354 |
-
|
| 355 |
-
# Define labels
|
| 356 |
-
id2label = {
|
| 357 |
-
0: "No binding site",
|
| 358 |
-
1: "Binding site"
|
| 359 |
-
}
|
| 360 |
-
|
| 361 |
-
# Print the predicted labels for each token
|
| 362 |
-
for token, prediction in zip(tokens, predictions[0].numpy()):
|
| 363 |
-
if token not in ['<pad>', '<cls>', '<eos>']:
|
| 364 |
-
print((token, id2label[prediction]))
|
| 365 |
-
|
| 366 |
-
# train
|
| 367 |
-
saved_path = train_function_no_sweeps(base_model_path,train_dataset, test_dataset)
|
| 368 |
-
|
| 369 |
# debug result
|
| 370 |
dubug_result = saved_path #predictions #class_weights
|
| 371 |
'''
|
|
@@ -376,12 +285,9 @@ with demo:
|
|
| 376 |
gr.Markdown("# DEMO FOR ESM2Bind")
|
| 377 |
#gr.Textbox(dubug_result)
|
| 378 |
|
| 379 |
-
#gr.Markdown("## Finetune Pre-trained Model")
|
| 380 |
with gr.Column():
|
| 381 |
gr.Markdown("## Select a base model and a corresponding PEFT finetune model")
|
| 382 |
-
|
| 383 |
-
# """ Pick a base model and press **Finetune Pre-trained Model!"""
|
| 384 |
-
#)
|
| 385 |
with gr.Row():
|
| 386 |
with gr.Column(scale=5, variant="compact"):
|
| 387 |
base_model_name = gr.Dropdown(
|
|
@@ -462,6 +368,7 @@ with demo:
|
|
| 462 |
inputs=[base_model_name,PEFT_model_name,input_seq],
|
| 463 |
outputs = [output_text],
|
| 464 |
)
|
|
|
|
| 465 |
# "Finetune Pre-trained Model" actions
|
| 466 |
finetune_button.click(
|
| 467 |
fn = train_function_no_sweeps,
|
|
|
|
| 150 |
"weight_decay": 0.2,
|
| 151 |
# Add other hyperparameters as needed
|
| 152 |
}
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
| 153 |
|
|
|
|
| 154 |
base_model = AutoModelForTokenClassification.from_pretrained(base_model_path, num_labels=len(id2label), id2label=id2label, label2id=label2id)
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
| 155 |
|
| 156 |
# Tokenization
|
| 157 |
tokenizer = AutoTokenizer.from_pretrained(base_model_path) #("facebook/esm2_t12_35M_UR50D")
|
|
|
|
| 158 |
|
| 159 |
train_tokenized = tokenizer(train_sequences, padding=True, truncation=True, max_length=max_sequence_length, return_tensors="pt", is_split_into_words=False)
|
| 160 |
test_tokenized = tokenizer(test_sequences, padding=True, truncation=True, max_length=max_sequence_length, return_tensors="pt", is_split_into_words=False)
|
| 161 |
|
|
|
|
|
|
|
|
|
|
|
|
|
| 162 |
train_dataset = Dataset.from_dict({k: v for k, v in train_tokenized.items()}).add_column("labels", train_labels)
|
| 163 |
test_dataset = Dataset.from_dict({k: v for k, v in test_tokenized.items()}).add_column("labels", test_labels)
|
| 164 |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
| 165 |
# Convert the model into a PeftModel
|
| 166 |
peft_config = LoraConfig(
|
| 167 |
task_type=TaskType.TOKEN_CLS,
|
|
|
|
| 180 |
test_dataset = accelerator.prepare(test_dataset)
|
| 181 |
|
| 182 |
model_name_base = base_model_path.split("/")[1]
|
| 183 |
+
timestamp = datetime.now().strftime('%Y-%m-%d_%H')
|
| 184 |
|
| 185 |
# Training setup
|
| 186 |
training_args = TrainingArguments(
|
|
|
|
| 225 |
|
| 226 |
# Train and Save Model
|
| 227 |
trainer.train()
|
|
|
|
|
|
|
|
|
|
| 228 |
|
| 229 |
return save_path
|
| 230 |
|
|
|
|
| 239 |
] # models users can choose from
|
| 240 |
|
| 241 |
PEFT_MODEL_OPTIONS = [
|
|
|
|
| 242 |
"wangjin2000/esm2_t6_8M-lora-binding-sites_2024-07-02_09-26-54",
|
| 243 |
+
"AmelieSchreiber/esm2_t12_35M_lora_binding_sites_v2_cp3",
|
| 244 |
] # finetuned models
|
| 245 |
|
| 246 |
|
|
|
|
| 257 |
with open("./datasets/test_labels_chunked_by_family.pkl", "rb") as f:
|
| 258 |
test_labels = pickle.load(f)
|
| 259 |
|
|
|
|
|
|
|
| 260 |
max_sequence_length = 1000
|
| 261 |
|
|
|
|
|
|
|
|
|
|
| 262 |
# Directly truncate the entire list of labels
|
| 263 |
train_labels = truncate_labels(train_labels, max_sequence_length)
|
| 264 |
test_labels = truncate_labels(test_labels, max_sequence_length)
|
| 265 |
|
|
|
|
|
|
|
|
|
|
|
|
|
| 266 |
# Compute Class Weights
|
| 267 |
classes = [0, 1]
|
| 268 |
flat_train_labels = [label for sublist in train_labels for label in sublist]
|
|
|
|
| 275 |
label2id = {v: k for k, v in id2label.items()}
|
| 276 |
|
| 277 |
'''
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
| 278 |
# debug result
|
| 279 |
dubug_result = saved_path #predictions #class_weights
|
| 280 |
'''
|
|
|
|
| 285 |
gr.Markdown("# DEMO FOR ESM2Bind")
|
| 286 |
#gr.Textbox(dubug_result)
|
| 287 |
|
|
|
|
| 288 |
with gr.Column():
|
| 289 |
gr.Markdown("## Select a base model and a corresponding PEFT finetune model")
|
| 290 |
+
|
|
|
|
|
|
|
| 291 |
with gr.Row():
|
| 292 |
with gr.Column(scale=5, variant="compact"):
|
| 293 |
base_model_name = gr.Dropdown(
|
|
|
|
| 368 |
inputs=[base_model_name,PEFT_model_name,input_seq],
|
| 369 |
outputs = [output_text],
|
| 370 |
)
|
| 371 |
+
|
| 372 |
# "Finetune Pre-trained Model" actions
|
| 373 |
finetune_button.click(
|
| 374 |
fn = train_function_no_sweeps,
|